PDB entry 3nj3

View 3nj3 on RCSB PDB site
Description: Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose
Class: hydrolase
Keywords: TIM barrel, xylanase, HYDROLASE
Deposited on 2010-06-16, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Thermotoga petrophila RKU-1 [TaxId:390874]
    Gene: Tpet_0854
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5IL00 (17-340)
      • expression tag (14-16)
    Domains in SCOPe 2.07: d3nj3a1, d3nj3a2
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Thermotoga petrophila RKU-1 [TaxId:390874]
    Gene: Tpet_0854
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5IL00 (17-340)
      • expression tag (15-16)
    Domains in SCOPe 2.07: d3nj3b1, d3nj3b2
  • Heterogens: ACT, SO4, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nj3A (A:)
    mghhhhhhenlyfqghmqnvslrelaeklniyigfaainnfwslsdeekymevarrefni
    ltpenqmkwdtihperdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtk
    eellnvledhiktvvshfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtk
    eadpdailiyndysieeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrr
    nlerfaklglqiyitemdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgft
    dkyswvpgffkgygkallfdenynpkpcyyaikevlekkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nj3A (A:)
    ghmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihp
    erdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktv
    vshfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndys
    ieeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyi
    temdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgyg
    kallfdenynpkpcyyaikevlekkie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nj3B (B:)
    mghhhhhhenlyfqghmqnvslrelaeklniyigfaainnfwslsdeekymevarrefni
    ltpenqmkwdtihperdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtk
    eellnvledhiktvvshfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtk
    eadpdailiyndysieeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrr
    nlerfaklglqiyitemdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgft
    dkyswvpgffkgygkallfdenynpkpcyyaikevlekkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nj3B (B:)
    hmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihpe
    rdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvv
    shfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysi
    eeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyit
    emdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygk
    allfdenynpkpcyyaikevlekkie