Lineage for d1bpda1 (1bpd A:9-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2715908Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 2716055Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries)
  8. 2716068Domain d1bpda1: 1bpd A:9-91 [18073]
    Other proteins in same PDB: d1bpda2, d1bpda3
    complexed with po4

Details for d1bpda1

PDB Entry: 1bpd (more details), 3.6 Å

PDB Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1bpda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpda1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOPe Domain Coordinates for d1bpda1:

Click to download the PDB-style file with coordinates for d1bpda1.
(The format of our PDB-style files is described here.)

Timeline for d1bpda1: