SCOPe 2.01: Domain d3l50a_: 3l50 A:

Lineage for d3l50a_ (3l50 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189226] (1 PDB entry)

8. Domain d3l50a_: 3l50 A: [179946]
   automated match to d1vkka_
   complexed with cl

Details for d3l50a_

PDB Entry: 3l50, 1.9 Å

PDB Description: the crystal structure of human glia maturation factor, gamma (gmfg)

PDB Compounds: (A:) Glia maturation factor gamma

SCOPe Domain Sequences for d3l50a_:

Sequence; same for both SEQRES and ATOM records:

>d3l50a_ d.109.1.2 (A:) Glia maturation factor gamma, GMF-gamma {Human (Homo sapiens) [TaxId: 9606]}
smvcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelper
qprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeir
ttddlteawlqeklsf

Timeline for d3l50a_:

• d3l50a_ is new in SCOPe 2.01-stable
  
• d3l50a_ appears in SCOPe 2.02
  
• d3l50a_ appears in the current release, SCOPe 2.08, called d3l50a1