Lineage for d3l50b_ (3l50 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037751Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037752Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1037866Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1037911Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species)
  7. 1037912Species Human (Homo sapiens) [TaxId:9606] [189226] (1 PDB entry)
  8. 1037914Domain d3l50b_: 3l50 B: [179947]
    automated match to d1vkka_
    complexed with cl

Details for d3l50b_

PDB Entry: 3l50 (more details), 1.9 Å

PDB Description: the crystal structure of human glia maturation factor, gamma (gmfg)
PDB Compounds: (B:) Glia maturation factor gamma

SCOPe Domain Sequences for d3l50b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l50b_ d.109.1.2 (B:) Glia maturation factor gamma, GMF-gamma {Human (Homo sapiens) [TaxId: 9606]}
smvcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelper
qprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeir
ttddlteawlqeklsf

SCOPe Domain Coordinates for d3l50b_:

Click to download the PDB-style file with coordinates for d3l50b_.
(The format of our PDB-style files is described here.)

Timeline for d3l50b_: