Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [189226] (1 PDB entry) |
Domain d3l50b_: 3l50 B: [179947] automated match to d1vkka_ complexed with cl |
PDB Entry: 3l50 (more details), 1.9 Å
SCOPe Domain Sequences for d3l50b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l50b_ d.109.1.2 (B:) Glia maturation factor gamma, GMF-gamma {Human (Homo sapiens) [TaxId: 9606]} smvcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelper qprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeir ttddlteawlqeklsf
Timeline for d3l50b_: