PDB entry 3l50

View 3l50 on RCSB PDB site
Description: The crystal structure of human Glia Maturation Factor, Gamma (GMFG)
Class: hormone
Keywords: GMFG, human, Glia Maturation Factor, Gamma, Structural Genomics, Structural Genomics Consortium, SGC, Growth factor, HORMONE
Deposited on 2009-12-21, released 2010-02-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glia maturation factor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: GMFG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60234 (2-135)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d3l50a_
  • Chain 'B':
    Compound: Glia maturation factor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: GMFG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60234 (2-135)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d3l50b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3l50A (A:)
smvcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelper
qprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeir
ttddlteawlqeklsf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3l50B (B:)
smvcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelper
qprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeir
ttddlteawlqeklsf