SCOPe 2.08: Domain d3l50a1: 3l50 A:7-140

Lineage for d3l50a1 (3l50 A:7-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189226] (1 PDB entry)

8. Domain d3l50a1: 3l50 A:7-140 [179946]
   Other proteins in same PDB: d3l50a2, d3l50b2
   automated match to d1vkka_
   complexed with cl

Details for d3l50a1

PDB Entry: 3l50, 1.9 Å

PDB Description: the crystal structure of human glia maturation factor, gamma (gmfg)

PDB Compounds: (A:) Glia maturation factor gamma

SCOPe Domain Sequences for d3l50a1:

Sequence; same for both SEQRES and ATOM records:

>d3l50a1 d.109.1.2 (A:7-140) Glia maturation factor gamma, GMF-gamma {Human (Homo sapiens) [TaxId: 9606]}
vcevdpelteklrkfrfrketdnaaiimkvdkdrqmvvleeefqnispeelkmelperqp
rfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeirtt
ddlteawlqeklsf

Timeline for d3l50a1:

• d3l50a1 first appeared in SCOPe 2.01, called d3l50a_
  
• d3l50a1 appears in SCOPe 2.07