![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein automated matches [190276] (12 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189512] (1 PDB entry) |
![]() | Domain d3l1tb_: 3l1t B: [179859] automated match to d1gu6a_ complexed with ca, edo, hec, so3 |
PDB Entry: 3l1t (more details), 2.3 Å
SCOPe Domain Sequences for d3l1tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l1tb_ a.138.1.3 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq dfiktvipqweeqarknglls
Timeline for d3l1tb_: