PDB entry 3l1t

View 3l1t on RCSB PDB site
Description: E. coli NrfA sulfite ocmplex
Class: Oxidoreductase
Keywords: multiheme, sulfite, nitrite reductase, c-type cytochrome, Electron transport, Heme, Iron, Metal-binding, Oxidoreductase, Transport
Deposited on 2009-12-14, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l1ta_
  • Chain 'B':
    Compound: Cytochrome c-552
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l1tb_
  • Chain 'C':
    Compound: Cytochrome c-552
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l1tc_
  • Chain 'D':
    Compound: Cytochrome c-552
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l1td_
  • Heterogens: CA, HEC, SO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l1tA (A:)
    eqtaapakpvtveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsr
    dynkprghafavtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgk
    warggpeivnnlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqs
    mvcgqchveyyfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpe
    yetwtagihgknnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalq
    kvvaerkqsindlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaia
    shgihmhapeeglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaigl
    nmeqikaekqdfiktvipqweeqarkngllsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1tA (A:)
    tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
    avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
    nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
    yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
    knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
    ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
    eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
    dfiktvipqweeqarknglls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l1tB (B:)
    eqtaapakpvtveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsr
    dynkprghafavtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgk
    warggpeivnnlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqs
    mvcgqchveyyfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpe
    yetwtagihgknnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalq
    kvvaerkqsindlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaia
    shgihmhapeeglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaigl
    nmeqikaekqdfiktvipqweeqarkngllsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1tB (B:)
    tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
    avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
    nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
    yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
    knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
    ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
    eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
    dfiktvipqweeqarknglls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l1tC (C:)
    eqtaapakpvtveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsr
    dynkprghafavtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgk
    warggpeivnnlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqs
    mvcgqchveyyfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpe
    yetwtagihgknnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalq
    kvvaerkqsindlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaia
    shgihmhapeeglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaigl
    nmeqikaekqdfiktvipqweeqarkngllsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1tC (C:)
    tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
    avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
    nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
    yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
    knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
    ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
    eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
    dfiktvipqweeqarknglls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l1tD (D:)
    eqtaapakpvtveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsr
    dynkprghafavtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgk
    warggpeivnnlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqs
    mvcgqchveyyfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpe
    yetwtagihgknnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalq
    kvvaerkqsindlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaia
    shgihmhapeeglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaigl
    nmeqikaekqdfiktvipqweeqarkngllsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1tD (D:)
    tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
    avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
    nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
    yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
    knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
    ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
    eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
    dfiktvipqweeqarknglls