Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (15 species) not a true protein |
Species Escherichia coli [TaxId:562] [187306] (30 PDB entries) |
Domain d3jyib_: 3jyi B: [178922] automated match to d1axba_ complexed with epe, po4; mutant |
PDB Entry: 3jyi (more details), 2.7 Å
SCOPe Domain Sequences for d3jyib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jyib_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg sqatmdernrqiaeigaslikhw
Timeline for d3jyib_: