Lineage for d3jyid_ (3jyi D:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1233330Protein automated matches [190161] (15 species)
    not a true protein
  7. 1233362Species Escherichia coli [TaxId:562] [187306] (30 PDB entries)
  8. 1233416Domain d3jyid_: 3jyi D: [178924]
    automated match to d1axba_
    complexed with epe, po4; mutant

Details for d3jyid_

PDB Entry: 3jyi (more details), 2.7 Å

PDB Description: structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis
PDB Compounds: (D:) Beta-lactamase TEM

SCOPe Domain Sequences for d3jyid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jyid_ e.3.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3jyid_:

Click to download the PDB-style file with coordinates for d3jyid_.
(The format of our PDB-style files is described here.)

Timeline for d3jyid_: