SCOPe 2.08: Domain d3jyib_: 3jyi B:

Lineage for d3jyib_ (3jyi B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d3jyib_: 3jyi B: [178922]
   automated match to d1axba_
   complexed with epe, po4; mutant

Details for d3jyib_

PDB Entry: 3jyi, 2.7 Å

PDB Description: structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis

PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d3jyib_:

Sequence; same for both SEQRES and ATOM records:

>d3jyib_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d3jyib_:

• d3jyib_ first appeared in SCOPe 2.01
  
• d3jyib_ appears in SCOPe 2.07