Lineage for d3jyib_ (3jyi B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450707Species Escherichia coli [TaxId:562] [187306] (39 PDB entries)
  8. 1450775Domain d3jyib_: 3jyi B: [178922]
    automated match to d1axba_
    complexed with epe, po4; mutant

Details for d3jyib_

PDB Entry: 3jyi (more details), 2.7 Å

PDB Description: structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis
PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d3jyib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jyib_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3jyib_:

Click to download the PDB-style file with coordinates for d3jyib_.
(The format of our PDB-style files is described here.)

Timeline for d3jyib_: