SCOPe 2.02: Domain d3jvyb_: 3jvy B:

Lineage for d3jvyb_ (3jvy B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [188980] (4 PDB entries)

8. Domain d3jvyb_: 3jvy B: [178854]
   automated match to d1fgcc_
   complexed with 017, cl, na; mutant

Details for d3jvyb_

PDB Entry: 3jvy, 1.6 Å

PDB Description: hiv-1 protease mutant g86a with darunavir

PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3jvyb_:

Sequence; same for both SEQRES and ATOM records:

>d3jvyb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniiarnlltqigatlnf

Timeline for d3jvyb_:

• d3jvyb_ first appeared in SCOPe 2.01
  
• d3jvyb_ appears in SCOPe 2.03
  
• d3jvyb_ appears in the current release, SCOPe 2.08