Lineage for d3jvyb_ (3jvy B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1322054Protein automated matches [190433] (11 species)
    not a true protein
  7. 1322115Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [188980] (3 PDB entries)
  8. 1322117Domain d3jvyb_: 3jvy B: [178854]
    automated match to d1fgcc_
    complexed with 017, cl, na; mutant

Details for d3jvyb_

PDB Entry: 3jvy (more details), 1.6 Å

PDB Description: hiv-1 protease mutant g86a with darunavir
PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3jvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvyb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniiarnlltqigatlnf

SCOPe Domain Coordinates for d3jvyb_:

Click to download the PDB-style file with coordinates for d3jvyb_.
(The format of our PDB-style files is described here.)

Timeline for d3jvyb_: