SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3jvyb_ (3jvy B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2060049Protein automated matches [190433] (11 species)
    not a true protein
  7. 2060132Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [188980] (3 PDB entries)
  8. 2060134Domain d3jvyb_: 3jvy B: [178854]
    automated match to d1fgcc_
    complexed with 017, cl, na; mutant

Details for d3jvyb_

PDB Entry: 3jvy (more details), 1.6 Å

PDB Description: hiv-1 protease mutant g86a with darunavir
PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3jvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvyb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniiarnlltqigatlnf

SCOPe Domain Coordinates for d3jvyb_:

Click to download the PDB-style file with coordinates for d3jvyb_.
(The format of our PDB-style files is described here.)

Timeline for d3jvyb_: