Lineage for d1fgcc_ (1fgc C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1321128Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1321657Domain d1fgcc_: 1fgc C: [59822]
    complexed with 2nc; mutant

Details for d1fgcc_

PDB Entry: 1fgc (more details), 1.9 Å

PDB Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
PDB Compounds: (C:) protease retropepsin

SCOPe Domain Sequences for d1fgcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgcc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d1fgcc_:

Click to download the PDB-style file with coordinates for d1fgcc_.
(The format of our PDB-style files is described here.)

Timeline for d1fgcc_: