SCOPe 2.02: Domain d3iosa_: 3ios A:

Lineage for d3iosa_ (3ios A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (10 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [186863] (1 PDB entry)

8. Domain d3iosa_: 3ios A: [178494]
   automated match to d1zzoa1

Details for d3iosa_

PDB Entry: 3ios, 1.6 Å

PDB Description: structure of mtb dsbf in its mixed oxidized and reduced forms

PDB Compounds: (A:) Disulfide bond forming protein (DsbF)

SCOPe Domain Sequences for d3iosa_:

Sequence; same for both SEQRES and ATOM records:

>d3iosa_ c.47.1.10 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvpaqlqfsaktldghdfhgesllgkpavlwfwapwcptcqgeapvvgqvaashpevtfv
gvagldqvpamqefvnkypvktftqladtdgsvwanfgvtqqpayafvdphgnvdvvrgr
msqdeltrrvtalt

Timeline for d3iosa_:

• d3iosa_ first appeared in SCOPe 2.01
  
• d3iosa_ appears in SCOPe 2.03
  
• d3iosa_ appears in the current release, SCOPe 2.08