Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Lipoprotein DsbF [142375] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142376] (1 PDB entry) Uniprot O53924 47-180 |
Domain d3iosa_: 3ios A: [178494] automated match to d1zzoa1 |
PDB Entry: 3ios (more details), 1.6 Å
SCOPe Domain Sequences for d3iosa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iosa_ c.47.1.10 (A:) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} tvpaqlqfsaktldghdfhgesllgkpavlwfwapwcptcqgeapvvgqvaashpevtfv gvagldqvpamqefvnkypvktftqladtdgsvwanfgvtqqpayafvdphgnvdvvrgr msqdeltrrvtalt
Timeline for d3iosa_: