Lineage for d3iosa_ (3ios A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369372Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1369704Protein automated matches [190100] (15 species)
    not a true protein
  7. 1369873Species Mycobacterium tuberculosis [TaxId:1773] [186863] (1 PDB entry)
  8. 1369874Domain d3iosa_: 3ios A: [178494]
    automated match to d1zzoa1

Details for d3iosa_

PDB Entry: 3ios (more details), 1.6 Å

PDB Description: structure of mtb dsbf in its mixed oxidized and reduced forms
PDB Compounds: (A:) Disulfide bond forming protein (DsbF)

SCOPe Domain Sequences for d3iosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iosa_ c.47.1.10 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvpaqlqfsaktldghdfhgesllgkpavlwfwapwcptcqgeapvvgqvaashpevtfv
gvagldqvpamqefvnkypvktftqladtdgsvwanfgvtqqpayafvdphgnvdvvrgr
msqdeltrrvtalt

SCOPe Domain Coordinates for d3iosa_:

Click to download the PDB-style file with coordinates for d3iosa_.
(The format of our PDB-style files is described here.)

Timeline for d3iosa_: