Lineage for d1hssa_ (1hss A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4068Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
  4. 4069Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
  5. 4091Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 protein domains)
  6. 4092Protein 0.19 alpha-amylase inhibitor [47709] (1 species)
  7. 4093Species Wheat (Triticum aestivum) [TaxId:4565] [47710] (1 PDB entry)
  8. 4094Domain d1hssa_: 1hss A: [17819]

Details for d1hssa_

PDB Entry: 1hss (more details), 2.06 Å

PDB Description: 0.19 alpha-amylase inhibitor from wheat

SCOP Domain Sequences for d1hssa_:

Sequence, based on SEQRES records: (download)

>d1hssa_ a.52.1.2 (A:) 0.19 alpha-amylase inhibitor {Wheat (Triticum aestivum)}
mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
ykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda

Sequence, based on observed residues (ATOM records): (download)

>d1hssa_ a.52.1.2 (A:) 0.19 alpha-amylase inhibitor {Wheat (Triticum aestivum)}
mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda

SCOP Domain Coordinates for d1hssa_:

Click to download the PDB-style file with coordinates for d1hssa_.
(The format of our PDB-style files is described here.)

Timeline for d1hssa_: