Lineage for d1hssa_ (1hss A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714923Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 2714924Protein 0.19 alpha-amylase inhibitor [47709] (1 species)
  7. 2714925Species Wheat (Triticum aestivum) [TaxId:4565] [47710] (1 PDB entry)
  8. 2714926Domain d1hssa_: 1hss A: [17819]

Details for d1hssa_

PDB Entry: 1hss (more details), 2.06 Å

PDB Description: 0.19 alpha-amylase inhibitor from wheat
PDB Compounds: (A:) 0.19 alpha-amylase inhibitor

SCOPe Domain Sequences for d1hssa_:

Sequence, based on SEQRES records: (download)

>d1hssa_ a.52.1.2 (A:) 0.19 alpha-amylase inhibitor {Wheat (Triticum aestivum) [TaxId: 4565]}
mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
ykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda

Sequence, based on observed residues (ATOM records): (download)

>d1hssa_ a.52.1.2 (A:) 0.19 alpha-amylase inhibitor {Wheat (Triticum aestivum) [TaxId: 4565]}
mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda

SCOPe Domain Coordinates for d1hssa_:

Click to download the PDB-style file with coordinates for d1hssa_.
(The format of our PDB-style files is described here.)

Timeline for d1hssa_: