Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (50 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (9 PDB entries) |
Domain d3h8qa_: 3h8q A: [177323] automated match to d1jhba_ complexed with cl, so4 |
PDB Entry: 3h8q (more details), 2.21 Å
SCOPe Domain Sequences for d3h8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h8qa_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mareelrrhlvgliersrvvifsksycphstrvkelfsslgvecnvleldqvddgarvqe vlseitnqktvpnifvnkvhvggcdqtfqayqsgllqkllqedlayda
Timeline for d3h8qa_: