SCOPe 2.01: Domain d3h8qa_: 3h8q A:

Lineage for d3h8qa_ (3h8q A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (6 PDB entries)

8. Domain d3h8qa_: 3h8q A: [177323]
   automated match to d1jhba_
   complexed with cl, so4

Details for d3h8qa_

PDB Entry: 3h8q, 2.21 Å

PDB Description: Crystal structure of glutaredoxin domain of human thioredoxin reductase 3

PDB Compounds: (A:) Thioredoxin reductase 3

SCOPe Domain Sequences for d3h8qa_:

Sequence; same for both SEQRES and ATOM records:

>d3h8qa_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mareelrrhlvgliersrvvifsksycphstrvkelfsslgvecnvleldqvddgarvqe
vlseitnqktvpnifvnkvhvggcdqtfqayqsgllqkllqedlayda

Timeline for d3h8qa_:

• d3h8qa_ is new in SCOPe 2.01-stable
  
• d3h8qa_ appears in SCOPe 2.02
  
• d3h8qa_ appears in the current release, SCOPe 2.08, called d3h8qa1