Lineage for d1jhba_ (1jhb A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168066Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 1168081Species Human (Homo sapiens) [TaxId:9606] [52848] (2 PDB entries)
  8. 1168082Domain d1jhba_: 1jhb A: [32772]

Details for d1jhba_

PDB Entry: 1jhb (more details)

PDB Description: human glutaredoxin in fully reduced form, nmr, 20 structures
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1jhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhba_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Human (Homo sapiens) [TaxId: 9606]}
aqefvnckiqpgkvvvfikptcpycrraqeilsqlpikqgllefvditatnhtneiqdyl
qqltgartvprvfigkdciggcsdlvslqqsgelltrlkqigalq

SCOPe Domain Coordinates for d1jhba_:

Click to download the PDB-style file with coordinates for d1jhba_.
(The format of our PDB-style files is described here.)

Timeline for d1jhba_: