| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [47627] (2 PDB entries) |
| Domain d1f3aa1: 1f3a A:80-221 [17701] Other proteins in same PDB: d1f3aa2, d1f3ab2 complexed with gsh |
PDB Entry: 1f3a (more details), 1.9 Å
SCOPe Domain Sequences for d1f3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3aa1 a.45.1.1 (A:80-221) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafki
Timeline for d1f3aa1: