Lineage for d1f3ab2 (1f3a B:1-79)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1852852Protein Class alpha GST [81360] (8 species)
  7. 1852958Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries)
  8. 1852962Domain d1f3ab2: 1f3a B:1-79 [32996]
    Other proteins in same PDB: d1f3aa1, d1f3ab1
    complexed with gsh

Details for d1f3ab2

PDB Entry: 1f3a (more details), 1.9 Å

PDB Description: crystal structure of mgsta1-1 in complex with gsh
PDB Compounds: (B:) glutathione s-transferase ya chain

SCOPe Domain Sequences for d1f3ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ab2 c.47.1.5 (B:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

SCOPe Domain Coordinates for d1f3ab2:

Click to download the PDB-style file with coordinates for d1f3ab2.
(The format of our PDB-style files is described here.)

Timeline for d1f3ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3ab1