SCOPe 2.07: Domain d1f3aa1: 1f3a A:80-221

Lineage for d1f3aa1 (1f3a A:80-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)

6. Protein Class alpha GST [81349] (8 species)

7. Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [47627] (2 PDB entries)

8. Domain d1f3aa1: 1f3a A:80-221 [17701]
   Other proteins in same PDB: d1f3aa2, d1f3ab2
   complexed with gsh

Details for d1f3aa1

PDB Entry: 1f3a, 1.9 Å

PDB Description: crystal structure of mgsta1-1 in complex with gsh

PDB Compounds: (A:) glutathione s-transferase ya chain

SCOPe Domain Sequences for d1f3aa1:

Sequence; same for both SEQRES and ATOM records:

>d1f3aa1 a.45.1.1 (A:80-221) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafki

Timeline for d1f3aa1:

• d1f3aa1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3aa1 appears in SCOPe 2.06