SCOPe 2.04: Domain d3gkla_: 3gkl A:

Lineage for d3gkla_ (3gkl A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d3gkla_: 3gkl A: [176721]
   Other proteins in same PDB: d3gklc_, d3gkld_
   automated match to d1mz8b_
   complexed with zn

Details for d3gkla_

PDB Entry: 3gkl, 2.2 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins

PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d3gkla_:

Sequence, based on SEQRES records:

>d3gkla_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records):

>d3gkla_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekvydmdnisvvtpkrhidihrgk

Timeline for d3gkla_:

• d3gkla_ first appeared in SCOPe 2.01
  
• d3gkla_ appears in SCOPe 2.03
  
• d3gkla_ appears in SCOPe 2.05
  
• d3gkla_ appears in the current release, SCOPe 2.08