Lineage for d3gkld_ (3gkl D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487541Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
    automatically mapped to Pfam PF01320
  5. 1487542Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1487566Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 1487567Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)
  8. 1487583Domain d3gkld_: 3gkl D: [176724]
    Other proteins in same PDB: d3gkla_, d3gklb_
    automated match to d1e0ha_
    complexed with zn

Details for d3gkld_

PDB Entry: 3gkl (more details), 2.2 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins
PDB Compounds: (D:) Colicin-E7

SCOPe Domain Sequences for d3gkld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gkld_ a.28.2.1 (D:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvaticdadatseeeldklithfgemtehpsgsdliyypeegddds
psgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d3gkld_:

Click to download the PDB-style file with coordinates for d3gkld_.
(The format of our PDB-style files is described here.)

Timeline for d3gkld_: