SCOPe 2.04: Domain d3gklc_: 3gkl C:

Lineage for d3gklc_ (3gkl C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)

8. Domain d3gklc_: 3gkl C: [176723]
   Other proteins in same PDB: d3gkla_, d3gklb_
   automated match to d1e0ha_
   complexed with zn

Details for d3gklc_

PDB Entry: 3gkl, 2.2 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins

PDB Compounds: (C:) Colicin-E7

SCOPe Domain Sequences for d3gklc_:

Sequence; same for both SEQRES and ATOM records:

>d3gklc_ a.28.2.1 (C:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvaticdadatseeeldklithfgemtehpsgsdliyypeegddds
psgivntvkqwraangksgfkq

Timeline for d3gklc_:

• d3gklc_ first appeared in SCOPe 2.01
  
• d3gklc_ appears in SCOPe 2.03
  
• d3gklc_ appears in SCOPe 2.05
  
• d3gklc_ appears in the current release, SCOPe 2.08