Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) automatically mapped to Pfam PF01320 |
Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
Protein ImmE9 protein (Im9) [47351] (1 species) |
Species Escherichia coli [TaxId:562] [47352] (18 PDB entries) |
Domain d3gklc_: 3gkl C: [176723] Other proteins in same PDB: d3gkla_, d3gklb_ automated match to d1e0ha_ complexed with zn |
PDB Entry: 3gkl (more details), 2.2 Å
SCOPe Domain Sequences for d3gklc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gklc_ a.28.2.1 (C:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]} khsisdyteaeflqlvaticdadatseeeldklithfgemtehpsgsdliyypeegddds psgivntvkqwraangksgfkq
Timeline for d3gklc_: