SCOPe 2.08: Domain d1gsda1: 1gsd A:81-209

Lineage for d1gsda1 (1gsd A:81-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d1gsda1: 1gsd A:81-209 [17669]
   Other proteins in same PDB: d1gsda2, d1gsdb2, d1gsdc2, d1gsdd2

Details for d1gsda1

PDB Entry: 1gsd, 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form

PDB Compounds: (A:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsda1:

Sequence; same for both SEQRES and ATOM records:

>d1gsda1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Timeline for d1gsda1:

• d1gsda1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsda1 appears in SCOPe 2.07