SCOPe 2.08: Domain d1gsdd2: 1gsd D:2-80

Lineage for d1gsdd2 (1gsd D:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
   Uniprot P08263

8. Domain d1gsdd2: 1gsd D:2-80 [118477]
   Other proteins in same PDB: d1gsda1, d1gsdb1, d1gsdc1, d1gsdd1
   duplicate of 1GSD A:2-80

Details for d1gsdd2

PDB Entry: 1gsd, 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form

PDB Compounds: (D:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsdd2:

Sequence; same for both SEQRES and ATOM records:

>d1gsdd2 c.47.1.5 (D:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d1gsdd2:

• d1gsdd2 first appeared in SCOP 1.73
  
• d1gsdd2 appears in SCOPe 2.07