Lineage for d1gsda1 (1gsd A:81-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326004Protein Class alpha GST [81349] (8 species)
  7. 2326017Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2326077Domain d1gsda1: 1gsd A:81-209 [17669]
    Other proteins in same PDB: d1gsda2, d1gsdb2, d1gsdc2, d1gsdd2

Details for d1gsda1

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form
PDB Compounds: (A:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsda1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOPe Domain Coordinates for d1gsda1:

Click to download the PDB-style file with coordinates for d1gsda1.
(The format of our PDB-style files is described here.)

Timeline for d1gsda1: