Class b: All beta proteins [48724] (178 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.12: SRA domain-like [159368] (2 proteins) Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA |
Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries) Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625 |
Domain d3f8ib1: 3f8i B:419-622 [175571] Other proteins in same PDB: d3f8ia2, d3f8ib2 automated match to d2zo0b1 protein/DNA complex |
PDB Entry: 3f8i (more details), 2.29 Å
SCOPe Domain Sequences for d3f8ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f8ib1 b.122.1.12 (B:419-622) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]} panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng nyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpvr vvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtreg kdrtrqlgltmqypegylealank
Timeline for d3f8ib1: