Lineage for d2zo0b1 (2zo0 B:419-625)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2433042Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2433043Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 2433052Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 2433063Domain d2zo0b1: 2zo0 B:419-625 [154711]
    Other proteins in same PDB: d2zo0b2
    protein/DNA complex

Details for d2zo0b1

PDB Entry: 2zo0 (more details), 2.19 Å

PDB Description: mouse NP95 SRA domain DNA specific complex 1
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d2zo0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zo0b1 b.122.1.12 (B:419-625) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng
nyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpvr
vvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtreg
kdrtrqlgltmqypegylealankeks

SCOPe Domain Coordinates for d2zo0b1:

Click to download the PDB-style file with coordinates for d2zo0b1.
(The format of our PDB-style files is described here.)

Timeline for d2zo0b1:

2433063
d2zo0b1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2zo0b2