Lineage for d2zo0b1 (2zo0 B:418-625)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813337Family b.122.1.12: SRA domain-like [159368] (1 protein)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 813338Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 813347Species Mouse (Mus musculus) [TaxId:10090] [159371] (6 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 813351Domain d2zo0b1: 2zo0 B:418-625 [154711]
    complexed with 5cm

Details for d2zo0b1

PDB Entry: 2zo0 (more details), 2.19 Å

PDB Description: mouse NP95 SRA domain DNA specific complex 1
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOP Domain Sequences for d2zo0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zo0b1 b.122.1.12 (B:418-625) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
mpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdn
gnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpv
rvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtre
gkdrtrqlgltmqypegylealankeks

SCOP Domain Coordinates for d2zo0b1:

Click to download the PDB-style file with coordinates for d2zo0b1.
(The format of our PDB-style files is described here.)

Timeline for d2zo0b1: