SCOPe 2.01: Domain d3f8ib_: 3f8i B:

Lineage for d3f8ib_ (3f8i B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.12: SRA domain-like [159368] (2 proteins)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
   Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625

8. Domain d3f8ib_: 3f8i B: [175571]
   automated match to d2zo0b1
   protein/DNA complex

Details for d3f8ib_

PDB Entry: 3f8i, 2.29 Å

PDB Description: Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group P21

PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3f8ib_:

Sequence; same for both SEQRES and ATOM records:

>d3f8ib_ b.122.1.12 (B:) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
hmpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvd
ngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkp
vrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtr
egkdrtrqlgltmqypegylealank

Timeline for d3f8ib_:

• d3f8ib_ is new in SCOPe 2.01-stable
  
• d3f8ib_ appears in SCOPe 2.02
  
• d3f8ib_ appears in the current release, SCOPe 2.08, called d3f8ib1