Lineage for d3f72a_ (3f72 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693115Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693146Protein automated matches [191027] (2 species)
    not a true protein
  7. 2693147Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)
  8. 2693151Domain d3f72a_: 3f72 A: [175529]
    automated match to d1u2wa1
    complexed with na; mutant

Details for d3f72a_

PDB Entry: 3f72 (more details), 2.31 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant
PDB Compounds: (A:) Cadmium efflux system accessory protein

SCOPe Domain Sequences for d3f72a_:

Sequence, based on SEQRES records: (download)

>d3f72a_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgv
tianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkk

Sequence, based on observed residues (ATOM records): (download)

>d3f72a_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgv
tianashhlrtlykqgvvnfrkgklalyslggeairqimmialahkk

SCOPe Domain Coordinates for d3f72a_:

Click to download the PDB-style file with coordinates for d3f72a_.
(The format of our PDB-style files is described here.)

Timeline for d3f72a_: