![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
![]() | Protein automated matches [190196] (7 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries) |
![]() | Domain d3eznb1: 3ezn B:1-230 [175329] Other proteins in same PDB: d3eznb2 automated match to d1e59a_ complexed with pg4 |
PDB Entry: 3ezn (more details), 2.1 Å
SCOPe Domain Sequences for d3eznb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eznb1 c.60.1.1 (B:1-230) automated matches {Burkholderia pseudomallei [TaxId: 320372]} myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgd
Timeline for d3eznb1: