Lineage for d1e59a_ (1e59 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2890977Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2891003Species Escherichia coli [TaxId:562] [64110] (2 PDB entries)
  8. 2891005Domain d1e59a_: 1e59 A: [64794]
    complexed with cl, vo3

Details for d1e59a_

PDB Entry: 1e59 (more details), 1.3 Å

PDB Description: e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate
PDB Compounds: (A:) phosphoglycerate mutase

SCOPe Domain Sequences for d1e59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e59a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]}
vtklvlvrhgesqwnkenrftgwydvdlsekgvseakaagkllkeegysfdfaytsvlkr
aihtlwnvldeldqawlpvekswklnerhygalqglnkaetaekygdeqvkqwrrgfavt
ppeltkdderypghdpryaklsekelplteslaltidrvipywnetilprmksgerviia
ahgnslralvkyldnmseeeilelniptgvplvyefdenfkplkryylgnadeiaakaa

SCOPe Domain Coordinates for d1e59a_:

Click to download the PDB-style file with coordinates for d1e59a_.
(The format of our PDB-style files is described here.)

Timeline for d1e59a_: