Lineage for d3ezna_ (3ezn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2891019Protein automated matches [190196] (7 species)
    not a true protein
  7. 2891029Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries)
  8. 2891030Domain d3ezna_: 3ezn A: [175328]
    Other proteins in same PDB: d3eznb2
    automated match to d1e59a_
    complexed with pg4

Details for d3ezna_

PDB Entry: 3ezn (more details), 2.1 Å

PDB Description: Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b
PDB Compounds: (A:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3ezna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezna_ c.60.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgdqeaiak

SCOPe Domain Coordinates for d3ezna_:

Click to download the PDB-style file with coordinates for d3ezna_.
(The format of our PDB-style files is described here.)

Timeline for d3ezna_: