SCOPe 2.07: Domain d3eznb1: 3ezn B:1-230

Lineage for d3eznb1 (3ezn B:1-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries)

8. Domain d3eznb1: 3ezn B:1-230 [175329]
   Other proteins in same PDB: d3eznb2
   automated match to d1e59a_
   complexed with pg4

Details for d3eznb1

PDB Entry: 3ezn, 2.1 Å

PDB Description: Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b

PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3eznb1:

Sequence; same for both SEQRES and ATOM records:

>d3eznb1 c.60.1.1 (B:1-230) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgd

Timeline for d3eznb1:

• d3eznb1 first appeared in SCOPe 2.01, called d3eznb_
  
• d3eznb1 appears in SCOPe 2.06
  
• d3eznb1 appears in the current release, SCOPe 2.08