SCOPe 2.01: Domain d3eqlo_: 3eql O:

Lineage for d3eqlo_ (3eql O:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein automated matches [190193] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [186933] (6 PDB entries)

8. Domain d3eqlo_: 3eql O: [175159]
   Other proteins in same PDB: d3eqlc_, d3eqlm_
   automated match to d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqlo_

PDB Entry: 3eql, 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin

PDB Compounds: (O:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d3eqlo_:

Sequence; same for both SEQRES and ATOM records:

>d3eqlo_ a.143.1.1 (O:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

Timeline for d3eqlo_:

• d3eqlo_ is new in SCOPe 2.01-stable
  
• d3eqlo_ appears in SCOPe 2.02
  
• d3eqlo_ appears in the current release, SCOPe 2.08