PDB entry 3eql

View 3eql on RCSB PDB site
Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin
Class: transferase
Keywords: RNA POLYMERASE HOLOENZYME, MYXOPYRONIN, ANTIBIOTIC, TRANSCRIPTION REGULATION, DNA-directed RNA polymerase, Nucleotidyltransferase, Transcription, Transferase, DNA-binding, Sigma factor
Deposited on 2008-09-30, released 2008-10-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-01-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3eqlc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3eqle_
  • Chain 'F':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3eqlm_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3eqlo_
  • Chain 'P':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, MXP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eqlC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3eqlE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqlE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypve
    

  • Chain 'F':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eqlM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3eqlO (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqlO (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypve
    

  • Chain 'P':
    No sequence available.