Lineage for d3eqle_ (3eql E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926369Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 926370Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 926371Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 926389Protein automated matches [190193] (2 species)
    not a true protein
  7. 926390Species Thermus thermophilus [TaxId:274] [186933] (6 PDB entries)
  8. 926399Domain d3eqle_: 3eql E: [175157]
    Other proteins in same PDB: d3eqlc_, d3eqlm_
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqle_

PDB Entry: 3eql (more details), 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d3eqle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqle_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

SCOPe Domain Coordinates for d3eqle_:

Click to download the PDB-style file with coordinates for d3eqle_.
(The format of our PDB-style files is described here.)

Timeline for d3eqle_: