Lineage for d1b28a_ (1b28 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3584Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 3585Protein Arc repressor [47600] (1 species)
  7. 3586Species Salmonella bacteriophage p22 [TaxId:10754] [47601] (10 PDB entries)
  8. 3611Domain d1b28a_: 1b28 A: [17445]

Details for d1b28a_

PDB Entry: 1b28 (more details)

PDB Description: arc repressor myl mutant from salmonella bacteriophage p22

SCOP Domain Sequences for d1b28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b28a_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage p22}
mkgmskmpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfkkegriga

SCOP Domain Coordinates for d1b28a_:

Click to download the PDB-style file with coordinates for d1b28a_.
(The format of our PDB-style files is described here.)

Timeline for d1b28a_:

3611
d1b28a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1b28b_