SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1b28a_ (1b28 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996372Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996373Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1996374Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 protein domains)
  6. 1996375Protein Arc repressor [47600] (1 species)
  7. 1996376Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 1996407Domain d1b28a_: 1b28 A: [17445]
    myl mutant
    mutant

Details for d1b28a_

PDB Entry: 1b28 (more details)

PDB Description: arc repressor myl mutant from salmonella bacteriophage p22
PDB Compounds: (A:) protein (regulatory protein arc)

SCOPe Domain Sequences for d1b28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b28a_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfkkegriga

SCOPe Domain Coordinates for d1b28a_:

Click to download the PDB-style file with coordinates for d1b28a_.
(The format of our PDB-style files is described here.)

Timeline for d1b28a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b28b_