Lineage for d1dxxb1 (1dxx B:9-119)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321178Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2321179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2321180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 protein domains)
    Pfam PF00307
  6. 2321198Protein Dystrophin [47584] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 2321199Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)
  8. 2321202Domain d1dxxb1: 1dxx B:9-119 [17406]

Details for d1dxxb1

PDB Entry: 1dxx (more details), 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin
PDB Compounds: (B:) dystrophin

SCOPe Domain Sequences for d1dxxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxxb1 a.40.1.1 (B:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwq

SCOPe Domain Coordinates for d1dxxb1:

Click to download the PDB-style file with coordinates for d1dxxb1.
(The format of our PDB-style files is described here.)

Timeline for d1dxxb1: