SCOPe 2.08: Domain d1dxxc2: 1dxx C:120-246

Lineage for d1dxxc2 (1dxx C:120-246)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Dystrophin [47584] (1 species)
   duplication: consists of tandem repeat of two CH domains

7. Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)

8. Domain d1dxxc2: 1dxx C:120-246 [17409]

Details for d1dxxc2

PDB Entry: 1dxx, 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin

PDB Compounds: (C:) dystrophin

SCOPe Domain Sequences for d1dxxc2:

Sequence; same for both SEQRES and ATOM records:

>d1dxxc2 a.40.1.1 (C:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
vknvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpd
lfdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvl
pqqvsie

Timeline for d1dxxc2:

• d1dxxc2 first appeared (with stable ids) in SCOP 1.55
  
• d1dxxc2 appears in SCOPe 2.07