![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
![]() | Protein Dystrophin [47584] (1 species) duplication: consists of tandem repeat of two CH domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry) |
![]() | Domain d1dxxb2: 1dxx B:120-246 [17407] |
PDB Entry: 1dxx (more details), 2.6 Å
SCOPe Domain Sequences for d1dxxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxxb2 a.40.1.1 (B:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} vknvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpd lfdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvl pqqvsie
Timeline for d1dxxb2: